SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015114 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015114
Domain Number 1 Region: 159-320,353-448
Classification Level Classification E-value
Superfamily Caspase-like 1.44e-80
Family Caspase catalytic domain 0.0000000747
Further Details:      
 
Domain Number 2 Region: 9-100
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-20
Family Caspase recruitment domain, CARD 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015114   Gene: ENSORLG00000012073   Transcript: ENSORLT00000015115
Sequence length 451
Comment pep:known_by_projection chromosome:MEDAKA1:16:17039183:17045728:1 gene:ENSORLG00000012073 transcript:ENSORLT00000015115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSVTQKCGMQKRDAEALRNCSVCLLKDLVVDELLIQALVKDGILTQNMAESIMVQKTSHH
RSFKLLLLLPKRGPRAFKSFCSALKETEQEHLCDLLTQEEEGREVCLDTPLINSEEQSEV
SSSMSYPIHDSEGLQLEMRTNTESMESSLDADSPINTPVLACSADFYLSHCQQSYRMNSS
PRGSVLVISNINFDPRAAPELDPRKGGEVDDEVLRKLFTELDYSVNFHRDLTAQDMKMVI
ENFCRRPDHQKVDSCVVCLLSHGVDGAIYGTDGQQLALDWVFEAFDNAHCPLLQNKPKMF
FIQACRGDEMDCGVEQIDGPARTFSPTCEQRDAGREEQGDADGRQRASTGRQRIKLPQRS
DMICGFASLKGTAAMRNTKKGSWFIQELNTALRLNARDTHLADILVQVNKRIKEREGYAP
GTAHHRCKEMSEFTSSLCKDLYLFPKYQPQC
Download sequence
Identical sequences H2M9D1
ENSORLP00000015114 ENSORLP00000015114 8090.ENSORLP00000015114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]