SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015210 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015210
Domain Number 1 Region: 242-442
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-48
Family DBL homology domain (DH-domain) 0.0000000335
Further Details:      
 
Domain Number 2 Region: 434-558
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-33
Family Pleckstrin-homology domain (PH domain) 0.0000185
Further Details:      
 
Domain Number 3 Region: 165-237
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-24
Family SH3-domain 0.0000555
Further Details:      
 
Domain Number 4 Region: 2-118
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-23
Family Calponin-homology domain, CH-domain 0.00056
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015210
Domain Number - Region: 727-793
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.0405
Family Glutamyl tRNA-reductase dimerization domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015210   Gene: ENSORLG00000012157   Transcript: ENSORLT00000015211
Sequence length 802
Comment pep:known_by_projection chromosome:MEDAKA1:21:11480283:11514524:-1 gene:ENSORLG00000012157 transcript:ENSORLT00000015211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLITLGVLESPKKSISDPEAFLQSSLKDGVVLCRLLERLNPGATEKIYPEP
KNDGECLSNIKEFLKGCTSFRVEPFEASDLLLGLNFSKVLNSLVALNKVTADIGVGSDSV
CARHSSAHRIKSFESLSSQASLGRSSKLLQSQFRSLDMSENSGQQLLVKARFNFQQTNED
ELTFNKGDIINVTRQEEGGWWEGTLSGRTGWFPSNYVREVKGSADKQVSPKSGTLKSPPK
GFEPPAISKTYYNLVLQNILETETAYSKDIQSLLTNYLRPLQNSDKLSSSDVALILGNME
EISTFQQMLVQSLEECTKLPESHQRVGSFFLNLMPQMKALYIGYCSNHPSAVNVLTQHSE
ALGEFMEGRGAVSPGILTLTTGLSKPFMRLDKYPTLLKELERHMEEIHLDRPDIQKCMVS
FKNLSAQCQEVRKRKELELQILTESIRLWEGDDIKTLGSVIYMSQVLVQSPMTEEKSERY
LLLFPHVLLMLSASPRMSGFIFQGKLPLTGMMVTKLEDCEAHKNTFELNGTLFDRLQVIC
TNQQDLQDWVEHLTRQIKHATATAPSHKPLTVPCHTLPSHPVTPSRHAEGRAMTVAPTYH
TLPHPSSHGTSHSTMMWGPLEPPNTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKSVK
KLLPKRKPERKQSEEEFALRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSKKFLNLPH
MCTQRGEKLCLQGLLLFSAVYRSRSLVDVVYALRDEVQELKQDNKKMKRTLEEEQRARKD
LEKVVRRVLKSINDPTWDETNL
Download sequence
Identical sequences H2M9L9
ENSORLP00000015210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]