SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015306 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015306
Domain Number 1 Region: 296-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-42
Family SPRY domain 0.00061
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily RING/U-box 1.61e-20
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 138-192
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000151
Family B-box zinc-binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015306   Gene: ENSORLG00000012231   Transcript: ENSORLT00000015307
Sequence length 435
Comment pep:novel chromosome:MEDAKA1:18:29402300:29403660:-1 gene:ENSORLG00000012231 transcript:ENSORLT00000015307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRKDLDEESFCCSICLDLLKDPVTIPCGHSYCMKCLQGLWDAEEKVPSCPQCRKTFTPR
PVLGKNVMLAALVEQLKKTGLQAAPAGLCYAGPEDVVCDVCTGRKLKAIKSCLSCPASYC
EEHLQPHLKAAALKKHKLVEPSKKLQENICSRHDEVMKMFCRTDQKSICYLCSVEEHRGH
DTVSRDVEQQIRSQQQTEVRRVKGLQEELEQDMAELKRRDAELKQLWLTEDHSHFLLNYP
SLPPLSESTPSASIHVRPLTYFEDVTAAVSELRDKLQDILREEWTNISLTVSHVDVLLYS
RQITMDPNTANRQLLLSEENRKVTAMEEPQSVSDHPDRFTDWFQVLSRESLTGRCYWEVE
RRGEYVKVAVAYKNISRSSSKGILGYNDKSWALDCFSDSFSFVHNNIRTSISARVPSRVG
VYLDHRAGVLSFYSV
Download sequence
Identical sequences H2M9W2
8090.ENSORLP00000015306 ENSORLP00000015306 ENSORLP00000015306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]