SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015957 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015957
Domain Number 1 Region: 47-124
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000929
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 132-174
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000157
Family Hairy Orange domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015957   Gene: ENSORLG00000012739   Transcript: ENSORLT00000015958
Sequence length 400
Comment pep:known chromosome:MEDAKA1:5:25207123:25208845:1 gene:ENSORLG00000012739 transcript:ENSORLT00000015958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERIPSAQPPPFAPKHPSMDIADMHGVDFPIHMFKPRRGMKGRDECKETYKLPHRLIEKK
RRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKTLSALLEQQQQKIVALQK
DLQISDHAGDDSEMFRSGFHLCAKEVVHYLASQESSTDLTPSRVISHLQKVATEVLHHQD
GPQPDEPLPQLSEEGKKPGTPDARPSETPAKNCVPVIQRTYHHGTGEQSGSDTDTDSGYG
GEHEKHKSQWLESHEKDRRLGTPEPHQAGIKKEDDEPRAKRSRSDSSEDEVLSVHSAGHP
GNYMGFSPNQPPFCLPFYVLPPAAAAAAAYLPMLEKCWYPGGMPVMYPGMSSSVAALETP
PSSLLTSRAGSPASLQTSVDSQALHKALKPAPPLNLQTKD
Download sequence
Identical sequences Q2L4U5
ENSORLP00000015957 ENSORLP00000015957 8090.ENSORLP00000015957 NP_001098201.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]