SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016232 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016232
Domain Number 1 Region: 48-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000013
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000000196
Family Hairy Orange domain 0.0000758
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016232   Gene: ENSORLG00000012953   Transcript: ENSORLT00000016233
Sequence length 298
Comment pep:known_by_projection chromosome:MEDAKA1:11:22931916:22933392:-1 gene:ENSORLG00000012953 transcript:ENSORLT00000016233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRNHDFSSSDSELDETIEVEKESADENGNMSSPHGSMSPTTSTQVQARKRRRGIIEKRR
RDRINNSLSELRRLVPSAYEKQGSAKLEKAEILQMTVDHLKMLHAAGGKGYFDAHALAMD
YRGLGFRECLAETARYLSIIEGLDSTDPLRMRLVSHLNNYATQREAHSGLSHLAWGSAFG
AAHLTHPLLLQQKTGAPLAPLTHSTSSSRHSGRVTPHSDPGSIRVPSTTAAPSTVLHPAL
VPSPASKISPPLLSALSAFPFAFGACPIITPTSTISPPAQSSNVGKPYRPWGMEIGAF
Download sequence
Identical sequences H2MCE7
8090.ENSORLP00000016232 ENSORLP00000016232 ENSORLP00000016232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]