SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017065 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017065
Domain Number 1 Region: 16-249
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.61e-89
Family Eukaryotic proteases 0.0000000973
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017065   Gene: ENSORLG00000013603   Transcript: ENSORLT00000017066
Sequence length 251
Comment pep:known chromosome:MEDAKA1:16:18752589:18753991:1 gene:ENSORLG00000013603 transcript:ENSORLT00000017066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHQLNHSAAMRSLVFVLLIGAAFALDDDKIVGGYECTPHSQPHQVSLNAGYHFCGGSLVN
QNWVVSAAHCYQSRVEVRLGEHHIRNNDGTEQFITSSRVIRHPSYNSYTIDNDIMLIKLS
TPATLNQYVQPVSLPSGCAPAGTMCLVSGWGNTMSPADDGDKLQCLNIPILSDSDCSNSY
PGMITNSMFCAGYLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAERNHPGVYAKVCIF
SDWLDSTMASN
Download sequence
Identical sequences H2MEQ3
ENSORLP00000017065 8090.ENSORLP00000017065 ENSORLP00000017065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]