SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017737 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017737
Domain Number 1 Region: 25-136
Classification Level Classification E-value
Superfamily PH domain-like 3.87e-34
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000041
Further Details:      
 
Domain Number 2 Region: 224-321
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.62e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 417-476
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000314
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017737   Gene: ENSORLG00000014142   Transcript: ENSORLT00000017738
Sequence length 488
Comment pep:known_by_projection chromosome:MEDAKA1:7:21531580:21534863:1 gene:ENSORLG00000014142 transcript:ENSORLT00000017738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGSKSKTESNRSSLLSQQENEKLEELLGRRCSSMATAVAQLFMALPHSPTMWSMQHTGVV
CFVKDNPQRSYFIRMFDMKVKKMVWEQELYNQIIYSTPRTFFHTFTADDCQVGLNFSDEG
EAEIFQNAVVEKISQRNNRQDKKQRPLPTPDRGSLPPVPPDKAGNHGSFHMATVDIQNPD
IQSSRYRTMPPPPAATAVVINNKKSKKSKKKGPKLSKADIGAPSGFTHVSHVGWDPNNID
PNLLKLFSQAGISEADLKDEKTSQLIYNVIEQSGGIEAVQQEANRAAAAPPPPPHGRQGA
LPPLPGSGSSAPAPPPPRGRSGPLPPLPGQSQRGSPTPNPPPPRGGLPPPPPSSRGGLPP
PPPQAPPSSKQGGGGPPPPPPPPPPPPPQTPIPSDFPPPPPSFDSPQPAQTSAGGEGRGA
LLDQIRLGKSLKKVENSDPAPPAAAEPAPGIVGALMMVMQKRSKVIHSSDESEDEGGDDD
DDDEEWDD
Download sequence
Identical sequences H2MGJ9
ENSORLP00000017737 8090.ENSORLP00000017737 ENSORLP00000017737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]