SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018661 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018661
Domain Number 1 Region: 11-136
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-21
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 2 Region: 471-547
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000692
Family SH2 domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018661   Gene: ENSORLG00000014884   Transcript: ENSORLT00000018662
Sequence length 553
Comment pep:known_by_projection chromosome:MEDAKA1:12:28333924:28337831:1 gene:ENSORLG00000014884 transcript:ENSORLT00000018662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLSFRTMSSPEVCWPMPMRAIGAQNLLTMPGGVSSAGYLHKKGGSQFSLMKWPLRYIII
HKGCVYYFKSSTSAAPQGAFSLNGYNRVMRAAEETTSSNVFPFKLVHFSKRHRTWYFSAA
SENERRKWMRHLRREIDHYNDRKESQIPSSDSDSDADSFYGTIERPMDLSHNFDPEDFGR
GYDEDDDGGGSRERRPQSALSIQSPATLPICNQLESRLCLNGPAHGGGQFQGGHCLRGRP
SGTPTQSANTAGPSFSSSNPSLPGKPSVSPLLKTGLHNKIGKPNPPPPTTKPPLPALKPP
FGTPFQTATCLIAVVVHRSFHPINKLKTDVEAVTAKPNSNCNRVQLSNEYKHQMATVLKY
NYKMVTTGVQISNSTVLKCKYQTVTTRQIVTTQVKISNSTLLKRLSPEGQSFRSQGEEVP
PDFRTKRDWDKPGGGDDSDDDYENVQLPDSVFIDSTETSFVEKLFKDEPIPPQDGLYGIR
NSGTKTSKVLVVWDTSIGKARNYRLFEENGCTFLESELTFPNLSALIEHYHSNPLPHHGS
LCLQKPYSKTLSF
Download sequence
Identical sequences H2MJ26
ENSORLP00000018661 8090.ENSORLP00000018661 ENSORLP00000018661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]