SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020160 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000020160
Domain Number - Region: 815-878
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000263
Family Homeodomain 0.024
Further Details:      
 
Domain Number - Region: 261-285,361-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000614
Family Classic zinc finger, C2H2 0.061
Further Details:      
 
Domain Number - Region: 885-914
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00201
Family Classic zinc finger, C2H2 0.076
Further Details:      
 
Domain Number - Region: 197-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0382
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020160   Gene: ENSORLG00000016111   Transcript: ENSORLT00000020161
Sequence length 999
Comment pep:known_by_projection chromosome:MEDAKA1:7:24940601:24943600:-1 gene:ENSORLG00000016111 transcript:ENSORLT00000020161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVPDEDTALQDSINEEDGENEPQTEEECLEKTSPKLCEDRELDNKSTNTFSNQNSPVSVL
SNQEAELESRLSDSSDRLSDFKTSSPPESQRDEESRSSKHKEETSSSLEKMRAAYANFLS
DSYWTGIGMDLKMGKTTSKANCDSTNGSAKSEFDWHQDALSKTLQQTLSPKPASKPNLFS
SVHLYRQTTKPCGSVFTGASRFRCKDCSAAYDTLVELTVHMNKTGHYQDNNHSKQSNSSA
SSSKSRKRNLQEMEGKEDAQKVLKCMFCGHSFDSLQDLSVHMIKTKHYQKVPLKEPIPVI
TPKLLPPAKKRAFESTRPCSPDSTTGVSGFTEAQRAAISSANNNRHGYQNGASYTWQFET
CKSQILKCMECGSSHDTLQQLTTHMMVTGHFIKVTNSASKKGKQLALDPLAVEKIQGLAD
PPTGDADAEKGSPKTLSPGGSEKESQGEQMSDKPEETDTKDDKQDGEDKKAGDGNFKYPY
LREEDLEQDSNGGGDILKSLANTVASAINKAQTGTPSWSAYPSIHAAYQLSSIIKSAPLS
ASPPVQLKQTFNHKLRPIAPKAKLYPDDDAPNLDIKKEKAGISDGKESQNIKFDLAENDD
SDCQDDASTSSKLDADCVTEVSEAIKGKLSPDFSDRGKTPSPAASNGRSTASEPLSDTSD
IVGVNPLSALQSVLNNHLGKANKPNNSRADKLSSHTQNIFAEINRSSEKLLGSPVRKRPP
NSFLFVGDDQPIDLTKSKSKSSSLLLQPSTPLPHKYALSDIADMVKVLPKATTPKPSVPS
RFPTTKLESDVRRFEDVSAEVYSVHKRKGRQSNWNPRHLLILQAQFASSLFQTSEGKYLL
SDLGPQERMHISKFTGLSMTTISHWLANVKYQLRKTGGTKFLKNMDTGHPVFYCNDCASQ
FRSPSTFISHLESHLGFQIKDMCKMPVEHQTKVEEPELSRPLGIRAAEALAVEEDVDSKF
KCKLCCRTFASNHAVKLHLSKTHSKSPDNHSQYVEMDKE
Download sequence
Identical sequences H2MN60
8090.ENSORLP00000020160 ENSORLP00000020160 ENSORLP00000020160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]