SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020293 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020293
Domain Number 1 Region: 293-389
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000293
Family DEATH domain, DD 0.01
Further Details:      
 
Domain Number 2 Region: 35-90
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000102
Family TNF receptor-like 0.0021
Further Details:      
 
Domain Number 3 Region: 89-150
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000157
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020293   Gene: ENSORLG00000016219   Transcript: ENSORLT00000020294
Sequence length 392
Comment pep:known_by_projection chromosome:MEDAKA1:9:26690624:26699909:-1 gene:ENSORLG00000016219 transcript:ENSORLT00000020294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITLILQTTKSQVVKLTAANLPPGLRVRRRRHFGACGEQEYPNGNICCLNCKAGTFVKSSC
TAAGQRGTCEECDYGTFTEHDNHLQKCVDCAKCGPDQEVAEQCTNTQNTKCRCKAGRFCN
PEEACEVCRKCLTCKSDEEIVRNCTFTSNTVCKKIPLKPGSSLDAVFFVLCVIPVVLFLV
AGGIFLKYKKKCGCRGFQVHTHSHFEACSSESSTKAKPRKISSNKGRMNFSDFPSMEVED
PHHKKKQLFSLPPVVMIHSGTGLSYPSPLSLRVRFTWSLLSKQEEEQLPTLIPVNGEQSL
RSCFELFEELDVDFHKKFFRRLDFSDNAIKSKDNLLYEDKIHELLNSWVEREGKKANLNE
LLKVLVELNQKRTAEKIMKKVLDNGQYCTESK
Download sequence
Identical sequences H2MNI8
8090.ENSORLP00000020293 ENSORLP00000020293 ENSORLP00000020293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]