SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021280 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021280
Domain Number 1 Region: 2-461
Classification Level Classification E-value
Superfamily Sema domain 6.8e-111
Family Sema domain 0.0000723
Further Details:      
 
Domain Number 2 Region: 464-513
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000379
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021280   Gene: ENSORLG00000017004   Transcript: ENSORLT00000021281
Sequence length 517
Comment pep:known_by_projection chromosome:MEDAKA1:23:21490171:21500295:-1 gene:ENSORLG00000017004 transcript:ENSORLT00000021281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFPVRTLINNVVSDPRTGRLYVGAVNSLYQLNSDLEVEFESKTGPQIDNRLCTPPVTTAC
EEAKDTNNHNKLLLVHSAKDILVVCGSVFRGICSLRNLSNINHVIYFSDSNGEKSYVAST
EEGLSVVGVMSYYMVGKTQLPVFLVGKGYSSHDSTKLIATRILQDYKDWGIFDSIIEASA
VQANPFVMRYLHDFRFAFTDNNFVYFLFSRTLGMQDMKIFTVIARMCEDDHNYYSYTELQ
LNCSATNKYNKAQAAFVGEPGQVLAKNLSSSDQYGKVSAQDKVLFVTFTSDEDPHSSAMC
MYPLQAINHRLEQLIGACYLKNGLINDKSVVYSPYASKEQEPCGVHPNNKNKIEHRQCCG
AEFLPSPLASKAEFALSTEPSVVHKGRMTAVAVAVEMGHAVAFLGTATGKVLKVHLSASS
RGHEQELGEVTGDEVNKNLLFDSSREHLFITTSNKISKVPVQACHLKTTCQDCVSMKDPY
CGWCVLEGKCSQKKDCGRSTERNTWLWSPDQKCVEIE
Download sequence
Identical sequences H2MRA1
ENSORLP00000021280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]