SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021591 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021591
Domain Number 1 Region: 345-559
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-49
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 569-654,747-803
Classification Level Classification E-value
Superfamily PH domain-like 0.000000483
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 3 Region: 872-1026
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000412
Family Cell cycle arrest protein BUB3 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021591   Gene: ENSORLG00000017258   Transcript: ENSORLT00000021592
Sequence length 1307
Comment pep:known_by_projection chromosome:MEDAKA1:22:15143677:15190036:-1 gene:ENSORLG00000017258 transcript:ENSORLT00000021592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIKDPLKPKPCSWCIQDSVPFAEENEGEPFDFDDDEMPEPPPTSQDRSKDGGVAAPPVPS
TAPSPADSVGRQCPVAEENEGYLGGKVNPYSVIDIAPIPPMEPKAQEGEGQDHNSSPGLT
SGYSVPVPCGYATPSGVPLITPAYTTPVIIRHLSVDEDAFSFSVTVLRTYNTSADSEEYP
PITEEDALAKWVSDPANTAWMESPDEVIYDDVPRENSDSNTDPDEMIYDDVEFGEEGGCS
SSPDNGWSSSEFESYDEASEGEGGPENGLPNAFMRGNTKKQMQKLVKAAKDGTKDGLEKT
KAAVKKGRSFIQTKSFCHGNEDSSQSEESELFIEVDCFNVEPVLCPAPEGLSQQQLVRRC
ILESILESEKNYLNALKRILEHYEKPLSQIEPRLLSDRKLKMIFYRVREILQCHFLFQIA
LASRVAEWDGLEMIGDVFVASFCKSMVLDAYSEYVNNFSTAMAVVRKTCISKPGFLDFLK
HRQETSSDRMTLYGLMMKPIQRFPQFILLLQDMLKNTPVGHADRLPLQMALTELETLAEK
LNEKKREADQRCEIRHISKAMNERYLNKLLSHGSRYLIRSDDMVETVYSERGEILKTKER
RLFLLNDVLMCATPNLRCQDGSGSGSGSVPLNQKFLLKWSVPLSLVEVLEFGSSEDAVGG
GGRLLAPHSGEKVVINAKPNKLYMGPGQLYQDLQNLIHDLSLVHQISSMISSLKGNYQNV
NSTVAQDWVSGLQRLILKKEEEIRAADRCRIQLQLPGKQDKTGRPTYFSAVFNTHSPAIK
QSWISNLQMAKLALEEDNVQGWFFAEDDGNQIKKQKHPLLLRQIPVIMSKLQEFKIECAV
HNPEPFINTESTADRPAMGHGCVWVASCTNQMGQIAIVAMQNSSPKVTECFNVESRILCM
AYVPAEQIQENDGDDNRATARDAPSVCLGMEEGSIIVYRSSQRSKKVRLQHFFTPEKSTV
TSLVYRKQSLFVGLVSGSVAVYSRSPDSLWDYEKPKLLKLGVLPVKAMLAVEEHLWASSG
GQVFIICTHTHCIQGKSGSFKESGTMISAVKIPSEDSWTFFVTLCNTLKTKHCLTPQHVW
AISIFTKTANLVYNAMIPCNQRVLVSSLLVCHGLLLVGTNLGVTVALSVPRLQGIPKVTG
RGMVSLHAHNGPVKFLVMATAVCNHLPDVLSPSPPSLPQPSEPQDVDGDRPPSDSATPSS
QGHGVWLGEAGCTAMALQDSLSSSSCGSLAPSQGSLEHGPEDGALYDTIHDAAHHQRARR
SSKVDVSSLLVVSGGLGHRRVTKKTKPSRHEDNTSTIMIWQIPLLSM
Download sequence
Identical sequences H2MS55
ENSORLP00000021591 8090.ENSORLP00000021591 ENSORLP00000021591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]