SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023229 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023229
Domain Number 1 Region: 13-271
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.12e-77
Family Eukaryotic proteases 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023229   Gene: ENSORLG00000018580   Transcript: ENSORLT00000023230
Sequence length 276
Comment pep:novel scaffold:MEDAKA1:scaffold4562:2131:4985:-1 gene:ENSORLG00000018580 transcript:ENSORLT00000023230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSTPLVLPVLLVLLHNSPGSLGALEGSSIIGGEDAAEGKWPWMVHLNITSDGLKRWRC
GGSLVAKQWVLTAAHCWDPSLSVNLRRSGVWVGARDLSHGAERYRRVTHVISHPGYEGGG
GVYKNDLALLRLDKALAFSQRVAPLSLVQTDDAFGPSSECWITGWGLVGNGVPLPDPETL
QQLQISIVPQRDCRQTYPWLTDDMLCAGSPAGGKDACKGDYGGPLVCRTPRGFVQVGIMS
SGSPDGCGLPGRPGVYTRVSSYLAFIKSNINRGGKA
Download sequence
Identical sequences H2MWI2
8090.ENSORLP00000023229 ENSORLP00000023229 ENSORLP00000023229 XP_004085925.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]