SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024010 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024010
Domain Number 1 Region: 53-173
Classification Level Classification E-value
Superfamily PH domain-like 6.72e-21
Family Pleckstrin-homology domain (PH domain) 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024010   Gene: ENSORLG00000019277   Transcript: ENSORLT00000024011
Sequence length 179
Comment pep:known_by_projection scaffold:MEDAKA1:scaffold637:9434:12396:1 gene:ENSORLG00000019277 transcript:ENSORLT00000024011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMESKVFVCASAADLQRWLQLIEDRRCRSTKQPSGPSHCALSYLLPCDEPWKREELKKYL
LHAPIWQWEGSPIQHMGELVCMSEVHITNSRQGRQERLLVLFPQDLLLLSVDSKRLNVKY
EGRLARRSVRAVERSALLGRLEFELTGELLEPLLVSCSHLEDYEDWMFHLQQTGAATLL
Download sequence
Identical sequences H2MYD1
ENSORLP00000024010 8090.ENSORLP00000024010 ENSORLP00000024010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]