SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024045 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024045
Domain Number 1 Region: 28-121
Classification Level Classification E-value
Superfamily ISP domain 0.0000000000301
Family Rieske iron-sulfur protein (ISP) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024045   Gene: ENSORLG00000019308   Transcript: ENSORLT00000024046
Sequence length 409
Comment pep:known_by_projection scaffold:MEDAKA1:scaffold1280:9159:36569:-1 gene:ENSORLG00000019308 transcript:ENSORLT00000024046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEMSAQKAKVVLLLDREAVDVLTDGVNFRKSPEGSCYIIFKSKDGLKACKNLCKHQGGLF
IQDMEDMGGRTVKCTKHNWKLDLSTMKYVNPPDSFLQDELDVESLEDGGVQLVELSPPDP
WLTDPREMEELQEGEVKKSCEKSSEHECSGCELEEEKIWLDQVMVSITKNSRGWWCGFKP
QSEVRDKVCKFCLFYIVFFHPDIHLPCDRNLEQSKVQLTNINVVPFGVWQNVDEQLRFMI
LMDGIHPEMDTCIIFDYKGRIAPNLSVITGHLILNTVDCTRPNGGKLPLKVDLMMSDFAG
GASGFPMTFYGGKYTDAWKASFIKNERKKLLNYKAQMVKSLQPKIYCPFAGYFVEAHPSD
KYIRDTNIKNKAEDLNTLINKLAPNILTWTPLPGTVLDLGLALRDPQDR
Download sequence
Identical sequences H2MYG3
8090.ENSORLP00000024045 ENSORLP00000024045 ENSORLP00000024045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]