SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024112 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024112
Domain Number 1 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.28e-24
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 3 Region: 194-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 3-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.16e-23
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 138-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 82-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 243-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000147
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 327-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000277
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 45-76
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000018
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000024112
Domain Number - Region: 415-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0771
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024112   Gene: ENSORLG00000019366   Transcript: ENSORLT00000024113
Sequence length 439
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig85:557787:575799:-1 gene:ENSORLG00000019366 transcript:ENSORLT00000024113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAAHLKTHMRTHTGEKPFSCKECDKSFNQISNLKTHMRTHTGEKPFFCKECNKSFRQLSN
LKTHMTSHTGEKAFTCTECNTSFNQISNFKTHLRTHTGEKPFSCKNCDKSFRQMSHLRAH
MITHTGEKAFSCIECEKSFSTASHLRTHMRTHTGERPFSCKACEKSFSQISHLKIHMSSH
TGEKPFSCKECDLSFITASHLTTHMRTHTGERPFSCKCKECDKSFSRISNLKTHMRTHTG
EMPFLCKECDKGFGHISNLKTHMRTHTGEKPFPCKECNSSFSTVSNLIRHIRTHTGEKPF
SCKECDASFSQRSNLKTHMRTHTGEKPFSCKECNASFCQISDLIRHMRTHTGEKPFSCKE
CDASFHQIYNLKTHMRIHTGEKPFPCEECDKSFSQRSNLKKHMRTHTGEKPFYCKECDKC
FRQTSNLKTHMRTHKGEKP
Download sequence
Identical sequences H2MYM0
ENSORLP00000024112 ENSORLP00000024112 8090.ENSORLP00000024112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]