SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024968 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024968
Domain Number 1 Region: 85-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000653
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000024968
Domain Number - Region: 22-47
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00119
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024968   Gene: ENSORLG00000020120   Transcript: ENSORLT00000024969
Sequence length 401
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig90:2346428:2347633:-1 gene:ENSORLG00000020120 transcript:ENSORLT00000024969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHQQNPLKGQLDNSLSTDKEFFYCHSCGKQYNTQIGYRRHLVAFHSTSAGKPCPEDFPD
LLENVNHLGDMPPTPEGSINTPVRERKYSCERCERRFYTRKDVRRHAVVHTGRRDFLCPR
CTQRFGRRDHLTRHLKKSHAQESSLMSQCASDPPLTPAKEESGLLPPDGGAVSKDSLEVF
PRDICSPYPLVSPVPGMGHTHMQGSLSAGMGVGPSQVQHQLQPPSAPQQQSLNNISRYQH
GFTTYPRSDMDSFLLDLQSAPPPQMNAVNSSTSTSPQRETVVGVTAGGDTHLMPCSPNIS
TAELSCSNMELGPLLGFLPFSLPPYSPHMGMGGLVMSYPPAATTSSSSSSSSTVLSGQAP
GTFSFFQPPQAHVPQGPAVHSHSQLPQPSSCLSHYYQAFQQ
Download sequence
Identical sequences H2N0Q2
ENSORLP00000024968 XP_004086444.1.28442 8090.ENSORLP00000024968 ENSORLP00000024968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]