SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025759 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025759
Domain Number 1 Region: 203-229,256-519
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-72
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 10-143
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.94e-35
Family Protein kinases, catalytic subunit 0.000000479
Further Details:      
 
Domain Number 3 Region: 1168-1281
Classification Level Classification E-value
Superfamily DEATH domain 6.48e-18
Family DEATH domain, DD 0.003
Further Details:      
 
Domain Number 4 Region: 535-564,636-745
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000332
Family Atu3015-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025759   Gene: ENSORLG00000020799   Transcript: ENSORLT00000025760
Sequence length 1317
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig107:43683:94596:1 gene:ENSORLG00000020799 transcript:ENSORLT00000025760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLNRSAPHPRIKIIDFGLAHKIDFGNDFKNIFGTPEFVAPEVVNYEPLGLEADMWSVGV
ITYILLSGASPFLGDNKQETLGNVSAVDFTFDEEFFSSTSALAKDFISRLLVKDPKKRMT
IQDSLQHPWIKPKDTQQALSRKESAVNMEKFKKFAARRKWKQSVRLISLCNRLSRSFLSR
SNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGLQHLLGSLNSYDINQPNKPTGKCPVD
GVAPCRSVRVLELGFFGGGVVMDLQSGANAVYYAARHGHVETLRFLHEKKCPLNVQDKSG
ETALHVAARYGNVDVVSYLCTIQADPNLADREQEIPLHCAAWHGYSAVARALCQAGCDVN
ATNREGESPLLTASARGFVDIVECLVEHRADLQATDKDGHTALHLAVRRCQVDVVRCLLK
HNCQQDQQDRHGNTALHIACKDGNLPIVIAICGAKANLDLPNKHGRTPLHLAAKNGSLEV
VRHLCLAGANIDAVTNDGKTAEDLASADRHEPIVSLLSKLKKDNLKLSFIQQLRPTQSVQ
PRIKLKLFGHSGAGKSTLLESLKCGILRSFFRRRRPRGNSTTRHPNSPVSSKPAVSVSIS
NLYPGCENVSVRSRSMMFEPSLTKGVLEVFSPVHSGLSTADEQATKAIDIQHANIHGVGD
FSVWEFSGNPVYHCSYDYFAADDITAIHLVLFSLEEPYETQLGHITYWLNQLKALTPPQD
SIVFGGRIPQPLAAVLVATHADLAGVPRAFSGEFSYDKERALLKEVRNRFGNDLQISDRL
FVMDAGASNSRDVKLLRSHLQELRAAVISVSSRFVIDAFVSLPVVASSKRCSPVTPLSER
LLAALPAWRKLNGPNQLMSLQQFVSDVQDNINPLVSQDHLRSVAQQLHSMGEISIMQSET
VQDILLLEPRWLCTSVLGKLLSVEAPKAIHHYRGRYRLEEVQALAPESDVEELLQILDAM
DICSRDATNPTMVDVPALIKTNGLHRSWTEDEDEDSLIYGGVRLVPVEHLTAFPCGLFHK
LQVNLCRWSHQQRPEEAGGEDSDGDIHLWTNGAKVSQSGVEAMVLLVNHGQGVEIRVRGH
DSDRAKSYTLLDTICSITESLLASTLPGLLTARYYLSPQQLREHHAPIMIYQPKDFIRAQ
VQRESSLTNTMGGYRESFSSILAFGCAEIYQQGILGTGVPVSELPLLARRKLCRMLDPPD
ALGKDWCLLAMNLGLTELVAKYSSATPNGAPHPEAPELQPSPTAALLQEWSRHRESTVGV
LMTKLRELGRRDAADFLLKASPVFKVNVEAVGGAQNGYLPTCNGGTSYNSISSVISR
Download sequence
Identical sequences H2N2S0
ENSORLP00000025759 8090.ENSORLP00000025759 ENSORLP00000025759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]