SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb000463 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bmb000463
Domain Number - Region: 30-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb000463
Sequence length 101
Sequence
MPVVGRVLNMTTEIYDVTEGDILKTFFVSPANNFCFHGKCSYYCDTGHAICGNPDMLEGS
FAAFLPSSDVAERKVWRHPWRRSYHKRRKAQWELQSDYCDT
Download sequence
Identical sequences Bmb000463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]