SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb001260 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb001260
Domain Number 1 Region: 1508-1714
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.83e-56
Family Protein kinases, catalytic subunit 0.00000234
Further Details:      
 
Domain Number 2 Region: 70-266
Classification Level Classification E-value
Superfamily Fibronectin type III 8.83e-27
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 919-1105
Classification Level Classification E-value
Superfamily Fibronectin type III 7.25e-24
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 286-511
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-16
Family YWTD domain 0.01
Further Details:      
 
Domain Number 5 Region: 644-862
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000144
Family YWTD domain 0.0027
Further Details:      
 
Domain Number 6 Region: 1327-1493
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000923
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 7 Region: 552-644
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000155
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 8 Region: 1111-1199
Classification Level Classification E-value
Superfamily YWTD domain 0.00000916
Family YWTD domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb001260
Sequence length 1861
Sequence
MHYDELQQQNFFLQCKIGCSLWRGGLEKSCQNVCNVTSETVFSRELYCVMGCNEALNTYF
QQLRDLYGTPHPPALVADSLTATSLSLVWESRWDSELGNITYLVQWRYEELPGTWQYFSN
TSHSDKTIITVDNLRPYTKYRFRIAIFLSGHVGAGEPLYSAPSVVISTLESGKPSSAPKA
LRAAAPDPSRVAISWEPGPFPNGPLISYVLRLTDTEPSTTDALEDMPASNNTLFYMFQNL
APAREYEVSVAMRNAVGEAVPSQQLILILGGEHNILAAPANDMLSDPVELYSTEHVITGV
GIDISSDSLFVSVLDGFVYQGSLSKKSVPEPILFSKNIVMKPLDLSVDWLNRHLYVLGES
LYTKEESSNVSSLTTWEIIRCDFDGNNPVVALTGFNSRPIHFEVDAYNGYLFWAMRGVER
GGLYRLDLASISNGVLHSSEMIVRDPHLGAFTVDHADFRILVAHLKRNTVLAVSLDGREV
TDFRSNTITPMFQSTRSIAYAGGLFYWTNGKEMLTEEHHAKSDSYFHNEYPLAYNTKIIQ
TTQVLVALRSCQPIPVPVNPPLGVQAVMGINRAKISWSSPHLLGHQGSGAWQQWTYHLQL
KNKRDGDIIDIKNTAESIHIVENLKQDAEYVIRVAAVTVSGSGPDGLSKADLSGENIVTL
IHRDDIKSFYITAISWYRDKLYLVTNTSTVKWFNITSHEHGMMANMDNVGSLAVDWVGKK
IYWSNPKQQLITRSSFDGSNREPVPIVTVAKELTIDSLAAYVYWNTGHAVEAAKLNGENK
MVYYPAQLFSGKQVMGLTADLENKWLYWLVRSYDGSELHRARTADTLSHSANEVSETLVS
RLGSTATLGPLCYFSGRLVWVQDAARAVLSDLSGKYTASLVPRVRVIAVRDPTLHAHSEL
IVAIPETINSSSITVEGASDRFNVTWAPARRVNLNNTRVYYDVSLNFFGQHSIEKTVETP
WIEVLDIDVAPYTAVEVSVRAHTPWGGGGTARTQLRTPQAPPAAPTAPRLYIQPKNNGGR
KVAIFRWEVPNRTNGIIRGYEVQCWSDNSRPAPCANTLSPSPTPTRTQIILKDLLPETTY
YFQVRACTDAGYGQYSEVVSGTTNEINPVPKVMISSQDAIKIVDLDSSESEIIPKSTGIP
VDFGISIEESLVYWVNNLEEIFSSRINGSGHYKLTSINGSATSLCFDWVSRSVYWTQMEV
TSLEAYATYRASLGIPNTRPQLSRIFTRKQPMYGLQILPLQQSLMWYEETGHPGLGTLMI
SDLMVLDIQSFFNKSNNKTKSDCNCPENPQVAKTFVIDMTEYNYEVYWIDPWVHRILAAD
MSGCKSPTAPKSVKGTVLSPVLAQLEWKTEPGLRYEVHWRTDDSTQSHKLKEHNTFEVWE
GGVANLTRLSAGTWYRAWVRARSAHSAETAASAPIRLRTYPQPTPLTLFSSPEPYSLRVL
WQPPTSYVVYRFKVEYTEAAPANGSWKECDRDGSDKWIAKELRPRTRYRFRLCLQYIANA
PPYFWPIDDQFVFETSGVCLDNDPNYIIMELMEGGDLLSYLRAKREFLSTPDSLTLLDLL
NMCVDVTKGCRYLEEMHFVHRDLACRNCLVAHRANGRVVKIGDFGLARDIYKNDYYRKEG
EGLLPVRWMAVECLVDGVFSCQSDVWAWGVLCWEILSLGQQPYPACTNREVLGYVRAGGT
PDRPPNCSPAFYELLQKCWSYRPERRPSFRECLSTVSALRDTTPPTTALPAHHHYLTLLP
DACSEAVDNRTYLLDENDNACLDEECPEQQQMEPSRLLPERAPKYLELAYESDSATGDGY
EVPRAGAGGAVRGAGGARSGTRNATVVPLRNGIAKRASLCADPRRLDLDFDLDKYVFKTT
F
Download sequence
Identical sequences Bmb001260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]