SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb001751 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb001751
Domain Number 1 Region: 41-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000379
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Domain Number 2 Region: 186-220
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 3 Region: 148-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000111
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb001751
Sequence length 241
Sequence
MGHINELCLKLFRYRAICWENYMESLCKDHFLQRQYRKLDGGVLWSRNERNLDCTVTFQT
HSILQRFMLHFDLLQLDCNDHLYVYDGAHATAPPKADLSCRNTKQQVGALFTRSNFVTLK
YVTDNWGTDANGFKLVITAVKDPKHGCKEFRCKQREFCVSADLTCDGVDHCADGSDEDTV
ALCPEHGCKEFRCKQREFCVSADLTCDGVDHCADGSDEDTVALCPGMLHGTPTKWIRFRQ
G
Download sequence
Identical sequences Bmb001751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]