SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb002267 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb002267
Domain Number 1 Region: 15-168,205-269
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000225
Family YWTD domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb002267
Sequence length 283
Sequence
MLMKYLVMLIVASAEAKIRIYLTDTPLQIIGTRLYKKELLTDLYQAPKELTYDSSSRNLY
FMYMDDSLQNSGRAYINIITKRAMKIDGIEKNKAIAVDSETGEVYFGTTDGLYKYDPINN
EATNIGLYNVNIMKLVVRNNQMYLLDANNHMIYKVYDHGKATIRMRNGKTVVEFDVDERG
NVHYVTLCGLYCAIENGEVIKNKDLDIVNNFIVHEEKTFAVTEEGLYDIDCENGTATRVA
RLDFAPRSMTFGDYGDIFYSLDDAIYRLRPIVSYQVYNLYGRS
Download sequence
Identical sequences H9JF83
Bmb002267 XP_004923730.1.14763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]