SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb002338 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb002338
Domain Number 1 Region: 21-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000226
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb002338
Sequence length 56
Sequence
MNTRCASSRIGNASGDACERRDPCQHGGVCISTDDGPVCECRDGDYEGAFCERGKY
Download sequence
Identical sequences Bmb002338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]