SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb004246 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb004246
Domain Number 1 Region: 164-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 2 Region: 252-290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0011
Further Details:      
 
Weak hits

Sequence:  Bmb004246
Domain Number - Region: 55-153
Classification Level Classification E-value
Superfamily SEA domain 0.00131
Family SEA domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb004246
Sequence length 294
Sequence
PFDTSSTTEAPPENIESITEDDASFDRKDDDLDTEGSGYPENRVEPEIKEKTLRVTFVVM
EPYREEYVNRDSIQFQNLSKSLADEVNKLFESLPGTQKASLVRIQSCVSDDFSCKVTLDI
VTTGYDNTDVIAQTLRDHIRNRSMLGKVTVNDNDFSAFVIDSANFTCRPNEIQCGDGACV
PESARCNNERDCSDWSDEKNCPIENIPDEEQEQTLEAETESYRPIERGDQPFASETTTPY
YDEDEVTVPYPEQFTCSLDEFKCDETRCIRRDEVCNNINDCHDGTDEVDCATRE
Download sequence
Identical sequences Bmb004246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]