SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb004310 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb004310
Domain Number 1 Region: 17-65
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000144
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb004310
Sequence length 68
Sequence
MGIFLSSGCECIRFTSTYGKERGTFSSPDYPRPYPPHLSCVLYTFIAAPHEIVEIIFTDF
DIYKDPIE
Download sequence
Identical sequences H9J9Q5
Bmb004310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]