SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb007640 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb007640
Domain Number 1 Region: 354-532
Classification Level Classification E-value
Superfamily Fibronectin type III 4.15e-19
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 204-241
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000011
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 147-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000681
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 297-335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 250-289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 6 Region: 43-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 544-716
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000548
Family Fibronectin type III 0.0083
Further Details:      
 
Weak hits

Sequence:  Bmb007640
Domain Number - Region: 732-827
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0122
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb007640
Sequence length 927
Sequence
MRSPRHELEKLIITGRIEGKRVVGRTPARWSDLVHIKHSEITPCSNNDFACGNESGTCLP
NSWVCDGERDCPEGTDEEPGGPRLGPQRTPRARPTCSGAPAGSASSDPGFATEKTIARTL
KNQTNRIARTPDVPSSCRTPPRTDRIFPANKTCLNWMYKCENGNCIPDWWRCDKINDCGD
NSDESGCGMVVPERKPVISVKVLPKCAKTYFTCPNDVCIPLSWVCDGMEDCAGGSDELGC
ERHAAVTPRPAPRCPADLTPCADGRACISDLLLCDGTPHCADGSDEAHCPGRTEQNPPME
CPPGYIQCDHSRCVAQAAVCNGREDCYDGTDEQNCFSKDNRAYQFLSIGVDQSSINSSSF
LVSCWMPQQKTVVYNFLPSISEVGDGKWMNMSWTNDSVYRFTNLKPFTNYNITFYIWDSR
LNKTYASSKYVNTTTGEGIPSPPLRVTVRQNIGSRVEVLWDRPEVPNGVIRYYKLYYSPP
DPPIVKIIHANDTKTQSVIFKGYFMPKTNYSFWVKSLNSLYTSNSSEVMYLTFDDGGDVD
DLANVSMARLNSSAVYLEWHKIRGVEGYLVQVRLPMDYAKRDPVKIQTNNITNTKIITKN
TSVQIDNLHECESYSFTVGLLGGPLARIIEIVTRENAKAPVKNLIAVYDDKNAEMKITWD
ANCDALRNPVTYLLKITEETRDRVSRYELTPSTVPIFKHVIRNVPVGGRYNICVKADVEG
AVETCTRARSRPVPPPVGVAAFLAPTGHLLVSWDDRPQHEHPEHKHKYEIIVSKKEIPED
LINPSPDMTTMTAEFSPLLMSAPRGSGTLYVGVRALTEDGYCSDLSEMPTLKMEGEAEEP
VSALSAVWWGAGAALAVGAVLGGALLHLLVRNRRLARSFLRFTAQSPHSPHTPRYDSRRG
HATITDQDDDDVPPIQGFSDDEPLVIA
Download sequence
Identical sequences Bmb007640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]