SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb007641 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb007641
Domain Number 1 Region: 254-480
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-32
Family YWTD domain 0.0000531
Further Details:      
 
Domain Number 2 Region: 3-119
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 7.59e-18
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.01
Further Details:      
 
Domain Number 3 Region: 541-582
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 582-615
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0018
Further Details:      
 
Weak hits

Sequence:  Bmb007641
Domain Number - Region: 485-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000112
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb007641
Sequence length 621
Sequence
MATGVMGKSLKGIPGVYLSRDAGLTWKRILKDYYFFNYGDHGGVLVVVKYFKSRGETRRI
LYSTNEGIEWNSYQFNADDLRIYGLMTEPGENTTTFTMFGSANDQHQWIIITLDLRNTFA
RNCTNEDYKFWSPSPPNSSVSCVLGSRNIFQRRLPHTNCYNGIDYQRPVRREVCECSRRD
FECDFGFMLSGEECIQNKSVKFDPYAVPVYCRPGQHYKRTKGYRKIDGDVCTISGYTPYA
SDIIPCPLEEPVEFMLVALRDKIARIDLSDNTTIYPVEGQNNIVAIEFDLKNNCIYWGDI
ELDKISRQCFNNGTTQEVVVDTDLASIEGMALDWISNVLFFVDGSRKKIEAVRTDLTNEG
RMRVTILDNNVLTKPRGIAVHPRAGYLFWNDWDRHAPIYWVDAMEDYIASSDLNGRYFRR
ILWDDTKVIHPFAVAVLKDKVYWDDWKAKSIFIADKDTGANVITINNSFSGLMDLKVFAH
FVQHGSNACSYKNTSCDALCLGAPGNSYSCLCPDGFKNVNGTCVCPDNSKPSVNMTCPIA
PGATCGPEQFTCKNANKCIPISWRCDANNDCGDLSDEMGCLCAPPMIPCDTSKCYMPHWK
CDGEIDCPDMSDEKGENIKKI
Download sequence
Identical sequences Bmb007641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]