SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb007884 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb007884
Domain Number 1 Region: 47-351
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.81e-32
Family NodB-like polysaccharide deacetylase 0.026
Further Details:      
 
Domain Number 2 Region: 5-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb007884
Sequence length 414
Sequence
MAECANGTHIGCSDGTCIPAEYFCDGSIDCADSSDEGWCDLTFDPNAAEPCDPVFCTLPE
CFCSKNGTQIPGNLVPSQTPQMITLTFSGAINHENWDTFTKHVFTTERKNPNGCPLKATF
FVSHPYTNYRHVQKLWNDGHEIAVNSVTHRGPEEWWSKNATVEDWFDEMVGEANIINRFG
RIHMEDFRGMRVPYLSVGWNRQFLMMQEFGFVYDATIVAPLNDPPFWPYTLDHKIPHSCT
GKNQYCPTRSYASLWEMVINPLVKGENTCAILDNCPFIQTGDDVYDALINNFKRHYLTNR
APFGIHLSSTWLRNNEYLVAFKNFLNELQKLPDVYFVTYKEILDWIKRPTPVVQLKKFQP
WQCKGRHFREAEIACAKPNTCKLPSKVLEHDKYMITCTECPRSYPWIRNEFGFE
Download sequence
Identical sequences H9JHJ0
Bmb007884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]