SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb008243 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb008243
Domain Number 1 Region: 856-937
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000021
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 773-810
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 3 Region: 234-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000012
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 816-857
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 730-768
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 642-725
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000441
Family I set domains 0.028
Further Details:      
 
Domain Number 7 Region: 275-315
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 19-59
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 58-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000128
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 10 Region: 178-214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 11 Region: 1245-1292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Laminin-type module 0.068
Further Details:      
 
Domain Number 12 Region: 90-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0034
Further Details:      
 
Weak hits

Sequence:  Bmb008243
Domain Number - Region: 148-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000301
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number - Region: 1298-1333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00103
Family Laminin-type module 0.028
Further Details:      
 
Domain Number - Region: 1182-1207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00949
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb008243
Sequence length 1338
Sequence
MGTAYLHQNIVTGRMIVRMGTICMAYQFKCSSGDCVPAESWCNGTKECNDASDETNCPCK
RGQFQCHDGSCINIALRCNGRNDCIPKGEDEFNCGTLSCPPEKFACSPTSSVPCAIRCNG
FPECDGNEDEDTVRRSIELKFLRECSHQCDGKCLPDANICDSITDCSDGSDELHCAQCDG
PDDYRCDTDECISRNWVCNGHFECPNGEDEADCNSTIVSTPTWYMRASRSPARKVPCDYS
EFTCYNGRCIPLARRCDNYYDCTDFSDEQNCHYYACDENSWQCRSGQCIPSSSYCDNVYN
CYDRSDEADCLPSTPAYENEYPPIVSTTLSPYYTTTRRDVGSSNYDRRPENPYGSENQGT
YSPYDDDARRPTTYSPYGPSSERPDPRRPYPPYGSVTTNRPDDRQDPYSSPPGGEYDPYG
QGAGSPDDRRPPYSQPGNQDISPGGGSPYNPEPENQPDNREDPSGGQPGGEYNPYGQGAG
GPDDRRPPYTQPGSQDVSPGGGSPYNPESGSQPNNREDPYGGQSGGEYDPYGRGAGSPDD
RRPPYGQSGSQDISLGGGIPYNPESVRQPDNRDPYGGQSGGEYDPYGRGVSGTDDRRQPG
SQDVGPGASGQGNSNQPENRPYRPESGNSVYETGEGQYGSGSQRGDRGGDVVLQCRDEGP
RRAPVRWIREGGRPMRPNYQERKGRLELFGVTPSDSGVYICQAPSYLRQPGAEVRVTLEV
ETSPVTVRPVFGVCKPHEATCGNGQCIPKSAICNSVFDCADHSDEDGCGASGQCEPNEFV
CANHKCILKTWRCDSEDDCGDGSDELNCGTPTPGSPCLAVEFSCASNNQCIPKSFHCDGQ
SDCVDGSDEIGCAQVYITKPPQPSYVRLNPGDSLTLRCEAVGVPVPLVSWRLNWGHVPPQ
CTFTSDNGIGVLTCPNMQPQHSGAYSCEAINNKATTFATPDAIVHVNRTDPCPVGYFNSD
ARSQSECIQCFCFGESTQCRSADLFTYNMPTPLGEGGTRFVTVTHQARGDISIGAPMNNE
YFYQPLRNGATVTRIVPGDMGWFKDAHPYVTLPETYNGNQLTSYGGHIKYTISPHGSGYG
SDDTAPTIIIKGKYFTLFHYYRGETTKTINIEARLTPENWLILDENGVQAPAQRSTIMMT
LDNVEMILLRADLHNAGVNITNFAMESAQHINVGLGAASLVEECTCPPGYEGLSCEKCAV
GYTRDQSGEWLGTCVRETCPPGTYGDPSSGYACKPCPCPLTNRENNFASTCALGPDGTVL
CNCRPGYEGSNCNICSSNYEGNPLMPGDSCKPKATKKCNPAGTKQVRFPDECACKVNVQG
RHCDQCKNDSFYLSEDFR
Download sequence
Identical sequences Bmb008243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]