SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb008674 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb008674
Domain Number 1 Region: 183-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 138-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb008674
Sequence length 220
Sequence
MPAPIVVYIISFFFFWLYVLADEPIGQNGPRATNNSVDAPDPRSPLGRVPPYQPPPAGMG
VGPNPMNSPGFWPHGIYTRVKAGIVRMLQLIYFISLSKVMTKAHYRSASLQKAIDVIHTD
PDDGPLNEGTEDDAGCITPCLKINFSCQISCTCIPMEKRCDGIADCAEAEDEAGCARSCD
EHENRTICHSTNVCIALEWLCDGDNDCGDFSDEINCVSYH
Download sequence
Identical sequences Bmb008674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]