SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb009288 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb009288
Domain Number 1 Region: 77-192
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.01e-32
Family Frizzled cysteine-rich domain 0.00037
Further Details:      
 
Domain Number 2 Region: 207-243
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 245-281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb009288
Sequence length 293
Sequence
MLRDIRGASNEGSPHKFRLMQVALNAVALLAITGALFAYFRANPAVQYVSQAVNRSTVVT
WPAPTDAPADKNPAPGVCLPVIVSFCHQHRISYNFTVFPNYIGHFGQRDAQQDLEIYDAV
VDVRCYELTALFLCSLFVPKCGPLGHMVRPCRSLCQETMRRCGFFLEVFGLSMPDYLQCE
IFPESTDTDVCLGNREVKEARFRAAKPVCVSGFQCDVKRCIPHDWRCDGHVDCADRSDEL
NCRVCKRSGDVHCGNQRCISQAHMCDGKVDCPWGQDERNCRKLRYSFRLFFVT
Download sequence
Identical sequences Bmb009288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]