SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb009843 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb009843
Domain Number 1 Region: 20-123
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.000000000000112
Family Frizzled cysteine-rich domain 0.0015
Further Details:      
 
Domain Number 2 Region: 433-471
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 129-166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 167-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb009843
Sequence length 472
Sequence
MVTTLLPKKYPTDINYEVPQCHSTHIPLCRGVLPYDLAGNAASVGGIEITALLPQIEYLV
ATNCSDRVRHFVCALLEPECNPPPYPPKLPCFNLCKAIVDNCDGLIPRDLSPAFNCQQYF
KNNCIAAKTPCYPREMTCGDGSCIPRDWICDGTRDCLSGEDEATCVQCDTREFRCPSGGC
IQKRWLCDGYADCSNGEDEDVEVCGSPVVAGEEPAGSAPAPAVRRPNRMQNSHGRQYSHN
TGENESSKELLVTSDSSNSLKRNFTRRPSLSRLTPYNRNMPHTIQTRHNNTQTTTAPVTK
HSSQDNERTTQNADDGDSEEDVNVGDLGFFEDLKKEPKEQPAKRVIAKSQMTKPKSSIEK
DAGGGAPAPTRLDQSISKLERVINGAALLKKAEAESKSEKAEELEESPEMNKGGTRSDDL
PTGPRGGSTSAHVSPCPTGELRCVDGRCITLAQLCDGTIDCSDHADEDNCFT
Download sequence
Identical sequences Bmb009843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]