SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb010043 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb010043
Domain Number 1 Region: 247-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000795
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 2 Region: 301-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 3 Region: 13-101,212-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000392
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 98-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.031
Further Details:      
 
Weak hits

Sequence:  Bmb010043
Domain Number - Region: 418-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family Laminin-type module 0.037
Further Details:      
 
Domain Number - Region: 359-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0243
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb010043
Sequence length 464
Sequence
MTKENRGGPSCDKCLFGYYNTVSDGPCVPCDCDPEGSDGSCEWDNKRHRVSCNCLPGFTG
HLCDSCESSNAVFPLCHDIPTEPPCKCDVRGIVDPTRECDEVCECKLNVIGERCDTCASG
HFGLSSDLREGCRPCYCSHVTDICELAAPDPNTPHDIVLPLGEAWMISDSIANETLEPSL
DEQGKPFVISYEIRLENAEIRAPVKPVSEVCSCPAGYTGVQCSSCAWSHARILHAAGAVP
PFECVPCACNEHASCDTVEGPCGSCQHNTTGAHCERCLPGHYGNPVQGACKPCACPLYLP
SNNFSPNCALASAEGDEFVCTQCPDGYTGDHCENCDFGYWGSPTTPGGSCQECACGGSPC
HPTTGLCLTCPPHTEGARCDLCQTITAYRGVICIFLMKEGYWFGAGGWQGAGSACVECAC
GAGALSAACDARSGLCACRQGWAGRACDSCARGHGGDHSSLTMS
Download sequence
Identical sequences Bmb010043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]