SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb010153 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb010153
Domain Number 1 Region: 162-271
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000106
Family Spermadhesin, CUB domain 0.0067
Further Details:      
 
Weak hits

Sequence:  Bmb010153
Domain Number - Region: 796-829
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000111
Family LDL receptor-like module 0.005
Further Details:      
 
Domain Number - Region: 12-89
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0772
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number - Region: 526-632
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0827
Family Spermadhesin, CUB domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb010153
Sequence length 912
Sequence
MPAFFELELVLFDSFTLGRFTSFTEDGCPDGYMQIQEASRPQVGGSWCGTSWGPSIYYSE
TKSITLIIRLLHLSKEQNNYNFDFRMAYKVLRREHATVRYGGTPLLDRPFFKLRPIAVPV
NISREDTNARSTRTPEYYLGDLISGTYCSRIFSDCDRKNCRLQSPNFPGVYPRNLTCYYA
VRQHEVPQGKHALIVVKQPNGQLISIRSQKALYAAQQERCDELQDYVTVYDGYTTRDPVV
LSFCGAGVAVPEAISSGPELLVEFTTSPFGTFLQPATLQSLHGFQLEVEVRFVDQQSPTY
AKNKRTCEFWIRGTGRGVLEHPQHSLPPNTTCLYHMQGIDTSGPSGRHIIYRRPSFSAPR
FRVWFSVLKFYVTNALNPNLPEDEYCGSHFNIWDDQTGSYDPFSDKERSVQMSRATSPQS
VIVGRPPTNATLIARFCRERAPRTCEHALLKKSRACTKTESFLSKGDSLTLELKLTQGTA
LKPVFFKALYEFVDLHQDGEPWGRGPCSRRFASRSFPEAPPDPPINFSSPRDVFLYGRGG
ARNISCTYRFEANPGEVVRLRVWGVRSGGRLCRSVHSAHAPWYRCAGDLTAAVRIFDRPW
KNIGSGIPRDCLCSDVGDYEFVSSSTVAELKFDVVNMTATDDFRSFGFEASVEFVRYDSV
CESTHRVYGASGDLDYPLHYQTRNHEPTLDNFTLLNNITVAPDLRHLCRTQNRIAVYAGG
LMPVYICPESPEQTNLLDTCYNPDLLLTDSTWSSHAALAVELIAVEAGNYFVSWLELSKR
EASGPGSVFALSGECTHRCASLDACIAAALWCDGVAHCPHGDDERLAHCSALLRLPAHYA
LALLAFAALTCCALVIALLDSWVSGFLNVSSIQCHFRVRISLSIGVCLVILHNSLWQLLG
RVGVVVQRSSRD
Download sequence
Identical sequences Bmb010153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]