SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb010493 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb010493
Domain Number 1 Region: 74-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000471
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 289-323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000785
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb010493
Sequence length 333
Sequence
MAIEGSLCARRFGLSNIDEIAIRHSDDSDPDEALDEVLKTASWSPNSCVCNGPVCRHYDC
PALCKRLCWQRYSLKRWTCHAIDEGPSIPLDYLCDGKYDCYDETDELDCSTASKRNSGFN
MAGGRSYGAQPEKLANVGYREYYGKFDSSVIYKNILKNIGIKTKSKKYGFVLTELLTLHE
TVALLQKLGLESNLETMNVKIVRDQCFSTISDIYERSTLMVTNIVQLNEIYDYLMTLNRM
LVDAMKRSRTGNERIIPTEGCMCKGTRCVLLRCSESCKRTCTVQHKFTKYSCNRKMNQFI
PVEKVCDGLPDCPDDEDENDCQKGRILFELLSY
Download sequence
Identical sequences Bmb010493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]