SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb010603 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb010603
Domain Number 1 Region: 88-109
Classification Level Classification E-value
Superfamily DPY module 0.0000824
Family DPY module 0.0027
Further Details:      
 
Weak hits

Sequence:  Bmb010603
Domain Number - Region: 47-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00977
Family EGF-like domain of nidogen-1 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb010603
Sequence length 138
Sequence
MAEKFLFLAPVLLLALQVSVDAQRYYHPRSYLGRDLYEHGRSISDNLVTCGPHTCGVGAH
CIHGSVRPVCACLAGYSGDPLSQCIKIECLDNSECRSHQTCVNQHCVNPCEGTCGINANC
DVRFNFKILADPANIDFP
Download sequence
Identical sequences Bmb010603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]