SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb012093 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb012093
Domain Number 1 Region: 17-45
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000956
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb012093
Sequence length 259
Sequence
MHPIDLKLGIHVENTLDGNCISIQYLCDGAPDCIDGYDEDSKLCTAAKRPPVEETASFLQ
SLLASHGPNYLEKLFGSKARDALEPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLR
SVFMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTEPESRRHPEEARPRGRRGASQRP
TTPVSAVRRRGGPTRPPGKPAGVPGYPAGPEPACRVGSQYTADRVAVVQYEYEQIDQGWP
EMRELLHNCIQVLIIRINK
Download sequence
Identical sequences Bmb012093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]