SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb012477 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb012477
Domain Number 1 Region: 92-247
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-20
Family YWTD domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb012477
Sequence length 258
Sequence
MHGGDDPLLIGSVKRVTVRALCAGVSRDTSNVSCPTARSRVKSSATGDNAISGAYINAQW
WSWWGIEGGALVSRYISDMMRDKTMQANQGEILLHEEGSIRGVTIDYVSGRIYWTVSGTG
AGARGRGAVAPGGHEGALRVAGLDGRRRVTLYSRRGAEPDDVIFSNLTRYIYWSDRGSSP
GVYRLGAAGGRAEALVRGRVRRVTALTLHEEGARLYFVDGYYGTLETVRTDGSGRTLLAE
FRLRPHGAPIAPHVYQDG
Download sequence
Identical sequences Bmb012477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]