SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb013884 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb013884
Domain Number 1 Region: 17-95
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000392
Family Hairpin loop containing domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb013884
Sequence length 126
Sequence
MVKLQVRSESVCLRPWAFERVPGKSLRGLDNTIIYTSTKEACLAACLNEVTSEAACRLAC
EIESEFLCRSFLYLGAPHSAAYNCRLYHLDHHTLPDGPSAYLNAERPLIDDGEPIGKYSE
NFCESK
Download sequence
Identical sequences Bmb013884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]