SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb015779 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb015779
Domain Number 1 Region: 6-51
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.00000000131
Family Blood coagulation inhibitor (disintegrin) 0.0009
Further Details:      
 
Domain Number 2 Region: 73-112
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.00000000327
Family Blood coagulation inhibitor (disintegrin) 0.0044
Further Details:      
 
Weak hits

Sequence:  Bmb015779
Domain Number - Region: 261-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family Integrin beta EGF-like domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb015779
Sequence length 343
Sequence
GNGKLDEGEECDCGTLNECHNSNPCCDPFTCRLTKEAQCASGECCERCQNFGPEFEPLPL
LTLSQPFEKSTGNFQLKPRGVVCRDATNECDLEETCTGLSGACPADSYRKNGESCEDGKG
YCFAGQCPTLSLQCERIWGTGTVGADKECFEQFNSKGAVTGHCGKDSNGHYIKCEMENVR
CGSLQCQLGNRYPVVTGMDEYYTRTVITIKGNEYECKATTGLPKHSEIAPLGLFRDGTPC
GDNLVCVNQTCTSIFPFIDHTKCPTDHNNHECSARGICSNLNKCVCNRGWTGPDCSQHDA
LPPSPTPYVPENATKAAYNMTKKETPYGYSYEFLLIFPLLTIV
Download sequence
Identical sequences Bmb015779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]