SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb015916 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb015916
Domain Number 1 Region: 1158-1258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.62e-31
Family Eukaryotic proteases 0.0045
Further Details:      
 
Domain Number 2 Region: 1094-1160
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.41e-16
Family Eukaryotic proteases 0.0077
Further Details:      
 
Domain Number 3 Region: 878-918
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 1289-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000537
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  Bmb015916
Domain Number - Region: 930-1032
Classification Level Classification E-value
Superfamily SRCR-like 0.000994
Family Scavenger receptor cysteine-rich (SRCR) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb015916
Sequence length 1335
Sequence
MLSEYRFAGSGYPRVAPTTRSGGLCSAALVGGALLAAVAVLAVAALAFYMGALKPDSGEP
IIAFEGTLRVTRGDVYGGAPGSPAWRERARRYSASLRQVFSGPSPLRQAFTGALVTGFGD
RRLDVHFRLYLDRRKIPSSVSNVEETLKNLILQDINTKNSAFGQIRVDPTSIVIKRDLEH
TYQSESHVKEALSESMETNHQKTLTPQNNQSSKDKTLQSRVGVVRKTTVKPNQTTKKTDP
DEPDIDTENIPVVQGTFQITKTEADITENKHSSSPRHEDKHKPATTTKVTTTTKSPTTKP
TTRTTTKRPITSTAKTRPFTIKSTLNVKPRTEPSLRKDTTTTKIKTTSTSTTSTSTMGTP
TTTTNVSQILLDLLTNENHYKDLPKIDTLFTVPHVIDNEPWRPITQPYFDSTPKASPKFE
IPDELNAEDRMGVAEVVDDVSILESMLTPIPPVQKRLTTTRRPGLYNVNPGLEAEVYAPS
PVYTSFTLPTFAPPLKNMETLGSKYPKPHPIPVDKIGSVVEATAEQDPSKMDDGKPVERP
PKDKTASAVLSVLQFAQQENTERVSVDENSTKLEESETEEEEELEFTKMRGSVEVVPDYE
MEITTTNVITLLPAKSNLGVNRPLRPRPKIKPELKTNKDNSRGFFRENIEPQKLVSSLNE
EYYKENENLNDDGSEFIDTKKTENSYPTELNHLTDSKNLTGIIEAIEAAESSTNSNRLPK
SNDDIHLPDGNINTDLPEGTYRVSYHVTGSVSSKQANKTQNLPAYELKLEPDIVLEIPVN
QTNSLSVEKLKQLANLATISDSNNNTLFRSPGGVISTKAIPSSYTLNQAGFQILTKTFNK
AQSTKQDENKLGKPDKAFGKPSKDNNVYFVKEVIEEDWCKEEQYVCANSRQCIDMIKVCD
GTPDCPLGDDEKSCVTLADELENNEVIPYNEEGYVMVRKRGVWGRLCVESFTDVVEQAHS
SLKLPDLGRAVCRAMTYNDAGWAREAREGRKASPHGYWEVWHNAGARAADTRLTFRRSAC
KRRKALRVRCTDLDCGIRPHADAQQPSGHPARGGVTGDIERGVPASHALAPLVQSHRRHV
LRRIRPRRPRRLSRGFGGTTNVSADTLQEVELPVISSAECRRRTRLLPLYRVTDDMFCAG
YDRGGRDACLGDSGGPLMSDTLQEVELPVISSAECRRRTRLLPLYRVTDDMFCAGYDRGG
RDACLGDSGGTTNESGRWYIYGVTSNGYGCARANRPGVYTKVSNYIDWIDSVIATNTPAH
NDTELDENESNEEFYADLEVAENRRHRVDTCRGHRCPLGECLPPSSVCNGFLECSDGSDE
WQCSKPLNNTSLDPD
Download sequence
Identical sequences Bmb015916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]