SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb016053 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb016053
Domain Number 1 Region: 69-176
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000196
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb016053
Sequence length 190
Sequence
MTRQRGESEAFSAEHISPITLPLGTPDWRSSAPRPPALSVGRLSEARLDGADPKRDHCNK
TVEIYEDVSSPPVTAENFGRPLTCTYRFRAFRGSPKDWILRIRFKKFKVGTLVNGTTCHK
GYMQIVDGNAKTDVSNRKEPGLFCGEIEQPQTFISETNFVKIVFHADNFTDQNYFSFDSR
YVIAVSCFLI
Download sequence
Identical sequences Bmb016053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]