SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb016568 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb016568
Domain Number 1 Region: 17-286
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-41
Family YWTD domain 0.0000234
Further Details:      
 
Weak hits

Sequence:  Bmb016568
Domain Number - Region: 293-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0173
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb016568
Sequence length 549
Sequence
RRQSVWSVQATKDDVVLLYSNGPEIRAFAQSKNEQFDVITSEKRIEAIDYDPVNEMIFWA
DSYDKTIKRSYMVNAMNGAVKIGFAQDLNMKGNSKPTALAVDYVGDNLYWTEVERLGSKP
RGRVLVARTDGRYRRVLVAAGLESPTALALDARAGRILWADAGTAPKIEIAWMDGSKRRP
LVTENIRHPTGLVIDHAMDRAVYWADTKLNTIEMMRHDGSQRRVILKGDLLRHPLSLDVF
ESSLYWVTRDTGELLRQDKFGRGVAFVISRDLVNPSGVKVYHPLRYNVSALTACSRAACS
HLCLVVPGGRRCTCPDQQPTPKRATQELDCDAPIEVPRPLPRICECENGGTCVERADGGL
ECRCGEAGAGPQCASPAAVRAGAGTGAAVLVPVLLVLLLGVAAGAAWFVIRKRPFGKGGL
SSLASSQSVSFRQGSNVEFGGVSEPAYTLEETAAAAAAAAAARKGRDFSNPMYDAVTRAV
AAGEPEPPLPGIYEVPDELKDKVASAVISPSSSETRHAAALGAGAVRALEPAADTGADTQ
GLVREDKHC
Download sequence
Identical sequences Bmb016568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]