SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb016570 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb016570
Domain Number 1 Region: 71-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000406
Family LDL receptor-like module 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb016570
Sequence length 114
Sequence
MNRSRGEGLGKAPAPYLMDPRRRCVWVSARASEAMHGVAERLTTPCRRRGLNRPTSTGVG
LRKNCDSRGPAYGACPMKQFQCANGKCIPMTWVCEGDDDCGDNSDESIEECKGM
Download sequence
Identical sequences Bmb016570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]