SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb017069 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb017069
Domain Number 1 Region: 25-133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000314
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 2 Region: 136-192
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000459
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb017069
Sequence length 195
Sequence
MNAVAPDTISLHYCNRELRIAEWGAESEGYIRTPGYPHFYVGDECRWRLIANPEQRIRVT
FLDVSLRSIGPFENECKDFVSVQDSNGDNLLYSCEQVDMPIKLTSTTNTVEVAVEARSKG
AYPKRGVLLHYKSIGCVTLSAPSSGYLVYRNEDVAHYMCNVNFVFVDTRQRARLLWCYDD
NRWNDTVPLCIGKTT
Download sequence
Identical sequences Bmb017069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]