SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb017305 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb017305
Domain Number 1 Region: 191-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000516
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 2 Region: 154-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000869
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  Bmb017305
Domain Number - Region: 27-77
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0248
Family Calcium ATPase, transduction domain A 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb017305
Sequence length 252
Sequence
MAEECTAGGGGAADEECPPVIVSWEGSADIQSGDILIVRIVDSLLLDALVQNQLKNDTLG
TNTSLADGERVHRALTQPAVYQVTRQGHEHCDVSDGMLLDITPLAEDGAKLFTLYDKDLT
EGVNLLIVFVSYVVVSDNWGSQCVRLKVTVKSDNCGETQDCSGKGVCYTNVSMEGYECQC
CSGFVGPHCEDRDSCNPSPCLNSGICVDVTQPPTGNGSNYRCLCPYGMFILFPLLLKWSD
RKTLFLSSSRVK
Download sequence
Identical sequences Bmb017305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]