SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb018395 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb018395
Domain Number 1 Region: 255-366
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-24
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 2 Region: 8-144
Classification Level Classification E-value
Superfamily C-type lectin-like 1.22e-21
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 823-887
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.36e-16
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 4 Region: 529-600
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.17e-16
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 176-249
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000101
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 6 Region: 133-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000681
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 467-530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000834
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 8 Region: 586-648
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000208
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 9 Region: 756-793
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000875
Family EGF-type module 0.033
Further Details:      
 
Domain Number 10 Region: 960-1028
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000222
Family Complement control module/SCR domain 0.0052
Further Details:      
 
Domain Number 11 Region: 407-478
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000292
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 12 Region: 642-680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.022
Further Details:      
 
Domain Number 13 Region: 1071-1117
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000198
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.012
Further Details:      
 
Domain Number 14 Region: 368-405
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000131
Family Spermadhesin, CUB domain 0.0081
Further Details:      
 
Domain Number 15 Region: 1024-1069
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000709
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Weak hits

Sequence:  Bmb018395
Domain Number - Region: 685-751
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000595
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb018395
Sequence length 1152
Sequence
MGDGNHSPSGWELKGLHCYKFFNIRHSWEKAAELCRRYGSELMVVDSYTENNMTANMVPA
SPSNNHYWLGLASVDDLRTNTLESAAGGLVSQYAGFWDLKQPNPKEGECVDVLVTSDSQS
WELTTCETLLPFMCKANACPAGTFHCSNGRCINAAFKCDKQDDCGDASDEMDCASECHFY
MASSGDVVESPNYPHKYPSFSECKWTLEGPQGQNILLQFQEFETEKSFDTVQILVGDGSV
EKKGFRASWKTESSNCGGVLRATPQGQVLTSPGYPNGYPGGLECMYIIEAQPGRIVSLEI
EDLELGMNRDYIVVKDGNTPSSPVLARLTGPGEDNEKVVISTTNHLYLYFRTSLGDSKKG
FNMRYSQGCKATIIAANGTFTSPAYGLTNYPNNQECLYRIKNPTGDCPPLKSGIGALASN
RDTAFGTVITFSCPIGQEFATGKPRLTTKCLDGGNWSTMYIPSCQEVYCGPVPQIDNGFS
IGSTNVTYRGVATYQCYAGFAFPTGQPIERISCLSDGRWERTPTCLASQCVALPDVPHAN
VTILNGGGRSYGTIVRYECEPGYVRSGQPVLLCMSNGTWSGDVPTCTKTICSKFPEIKNG
YIVDQSRTYMFGDEARAQCFKGYKLNGPSILRCGANQEFDQAPTCEDINECLSSQCDSVS
TECKNTQGGFFCPCRTGFAPSLDCRPVGDLGLINGAIPDESISTSTPEPGYNSGMVRLNN
GGGCTIEAQYVKFKIQDYVGAPCLKLEVMGCARLDCLDINECSENNGGCEQKCLNTPGNF
SCACNLGFELYSSNGTAGFSIELSETGERDGDTYQRNKSCVPVMCPPLAPPENGQLLSTK
KSYHFGDTVHFQCDFGYVMSGFSTLQCTSSGTWNGTAPECQYARCVTLSDDKNDGLRVIR
DDPESVLVPYRDNVTITCTSPGRHLRNTLTSSFRQCVYDPKPGLPDYWFSGAQPQCPRQD
CGIPMPTPGAEYGQYLDTKYQSSFFFGCQNTFKLAGQTSKHDNVVRCQANGIWDFGDLRC
EGPVCEDPGRPADGYQIARSYEQGSEVLFGCSRPGYILINPRPITCMREPECKVIKPLGL
ASGRIPDSAINATSERPNYEAKNIRLNSVTGWCVRWYIRDKQCLSRDAGHTALYTTRYFS
INTNLSRYIIIA
Download sequence
Identical sequences Bmb018395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]