SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb018557 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb018557
Domain Number 1 Region: 269-303
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 315-352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 358-396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb018557
Sequence length 401
Sequence
MKLSKKGFMVGVTNRADETAPPGHVCYSNEHCRLWDKESRCEFVILNLFGRCACNSYYKQ
NGDKCVLSKISPYATEAVIAEQDSALSPMNGPQNTMNSNGQTSFSAESGFNERNQARPSK
TPIFSDNDVLSTEDDNLLMQAVLKVPTIEPAKKLPVSNRKEGEPNETVGVNEMTANLHAN
DQPVYRVVTQPTVDKKSNKKTGSTKETSEDKQRIRTDVSGDLGPSSLGMPCMTDAQCHLV
DPHTKCLNKRCDCAHRTNSTSACSARNRGCLPGTFQCRSTGTCISWYFVCDGRKDCSDGS
DEKCQGTGRDGTGERCPMNSFRCGGPGSPCVSRAARCDGTPQCPGGEDERNCKATRRRGC
PRHTFRCGSGECLPEYEFCNAIISCKDASDEPPHLCTEQSR
Download sequence
Identical sequences Bmb018557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]