SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb019660 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb019660
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000915
Family YWTD domain 0.00067
Further Details:      
 
Domain Number 2 Region: 85-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000709
Family EGF-type module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb019660
Sequence length 149
Sequence
MNTISSCNYDGSGRRLILHSTEVLRHPFSITTFEDWVYWTDWDKTAVYRANKFNGKDVEA
ITSTHTLQNPMVIHVYHPYRQPDGVNHCAAVNGHCSHLCLPAPRFGPNSPRVSCACPNGL
KLLPDDQMCVEDSKYHFLPFYNNFRSIGD
Download sequence
Identical sequences Bmb019660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]