SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb019690 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb019690
Domain Number 1 Region: 1071-1227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-24
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 544-634
Classification Level Classification E-value
Superfamily Immunoglobulin 4.4e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 313-426
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 1254-1398
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000336
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 5 Region: 647-724
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000154
Family I set domains 0.056
Further Details:      
 
Domain Number 6 Region: 10-96
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000864
Family I set domains 0.022
Further Details:      
 
Domain Number 7 Region: 390-481
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000138
Family I set domains 0.017
Further Details:      
 
Domain Number 8 Region: 895-976
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000255
Family I set domains 0.026
Further Details:      
 
Domain Number 9 Region: 219-303
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000026
Family I set domains 0.025
Further Details:      
 
Domain Number 10 Region: 798-871
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000999
Family I set domains 0.021
Further Details:      
 
Domain Number 11 Region: 727-767
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000111
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 12 Region: 120-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000754
Family V set domains (antibody variable domain-like) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb019690
Sequence length 1408
Sequence
PPEVTVFVRIIEPSNIRDLHVGSSVNYTCQAQSRITNRLRIAWSKADGYLPQGRSQVDEN
SGVLLLTNLQTSDSGQYICQTSDGYSTAQDVVTLIVPVSTEVTKVTINVRAKPSWPSQEK
LTVSPTSLSIDEGQSSRAVCTGTQGVPAGSIEWIRQDNAPFVANVRSDNGVLYIEYARPE
NDGIYVCQSSSSNVSPQSIIITIIPTYSPDPAKESNISISVDSLKVPAGGSGKIDCNPDG
TILPTIKWSKHGGEFGSETSQRGNTLIINNAKEDDQGYYLCEGIVNGATIASSYVYVEIE
RRDPPQVDIWPQGERAVTLGTEYELICRVLGGVPEPDVMWSRGGSRPLSSYVHIRPQNTL
KFDHVDVNDEGEYFCTATNVAGTATARSVIKVRSPPVITITPASFLEAPLGSSVTVECRA
DGYPLPMVSIKTSADLRELVRPTPSLAALKIPSIAERDDGDYICTATSAAGTIEEPFAIR
VSRGDIGVEYEFGGSGDDEFPVDYNPNNPTGRSDTLIAYENEPEITIFLYNRYTGEVVKA
NYTNLQVVTRPKITLRPANQTVRPGQSLTVECLVEGDEILDVTWRYDREPSRRVEIRGPV
LVFNNIEVEDAGIYYCIARSRYGNDTATANVIVTENTDRPTVESHNNEQYAHSGAAVHLG
CNVSQPNLRIYWTKDGRPVPRSRQKTDGSLFIKVAQKSDSGRYECFVRDQYGRRSSNYVN
LHIEGIKCSELDFRCSDNSGCIDKSLVCNGFRDCYDDSDEENCLYRNKRYFKSWQSEDEL
LPVGARDANSASLVYIDQPRRKFRVSENVEVICKGRSRDVTFKWERPDTNLYLVTNPFGG
GSRLLINSVQESDAGVYRCIGTDPFGISSYDDFVLEIEPGSGNAVYPGNRDLPVTHYSAR
LREAVDMPCNHDLNEPVIIEWKREYSPLPAEVRSNQPILHLESVTEADAGIYVCRVSNQE
VTVTAKAILRVIGVVPLFKGKSWLSLPPLKDAYRQFDIEVYFKPTDLNGLENYDYGALKN
ECIFFSVGHSCQSGRGCVDAVCAVGTVRSPMLPKTALQAMRFQVWRFEALRVHSTIVDSV
AFFIRSVQRVDLNGLILYNSQNQGRTGDYIGLRLLDGVPEFIFDAGAEPVIVKGDRPLQL
NVWHSIRVSRTDSKVTMDVDDTGPFITDSEEPWSAVLELNQPMYIGGVPDIDQLPAGLAG
SDGFIGCVSTLILGHDEKNIMLDSLEQYGVDECRSCTPNLCVNDGICQEARNERGYMCIC
APGFAGWNCERTGEACRAGLCGPGKCTETVDGSTPVVLTSDRPLPANQWIDIQIARLADS
VSMKINLVRSFERRLDRPAESLRFETPMFVGGVDDSTVVVNPNAGVSGGFSGCIKDVVLN
SNAVDINSSIKSSNIQECNTYDRGDIQA
Download sequence
Identical sequences Bmb019690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]